SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q4ESR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q4ESR9
Domain Number 1 Region: 23-114
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 7.72e-29
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.00037
Further Details:      
 
Domain Number 2 Region: 115-152
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000328
Family Prokaryotic DksA/TraR C4-type zinc finger 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q4ESR9
Sequence length 156
Comment (tr|A0A0Q4ESR9|A0A0Q4ESR9_9SPHN) RNA polymerase-binding transcription factor DksA {ECO:0000256|HAMAP-Rule:MF_00926} KW=Complete proteome OX=1735679 OS=Sphingomonas sp. Leaf208. GN=ASE69_01880 OC=Sphingomonadaceae; Sphingomonas.
Sequence
MATVMNRVDDTGNSSREAANDSGEDGYRPDADEPFMSLKQQAYFRRKLQEWKESILRESQ
ETLSQLQVDSLREADLTDRASSETDWSIELRTRDRQRKLVSKIEAAIRRIDEGEYGYCEV
TGEPISLARLEARPIATMTVEAQERHERNEKVSRED
Download sequence
Identical sequences A0A0Q4ESR9 A0A0Q4IUB4
WP_056058504.1.93193 WP_056058504.1.98745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]