SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q4MPS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q4MPS0
Domain Number 1 Region: 9-109
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 8.89e-38
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.00000207
Further Details:      
 
Domain Number 2 Region: 111-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000456
Family Prokaryotic DksA/TraR C4-type zinc finger 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q4MPS0
Sequence length 151
Comment (tr|A0A0Q4MPS0|A0A0Q4MPS0_9GAMM) RNA polymerase-binding transcription factor DksA {ECO:0000256|HAMAP-Rule:MF_00926} KW=Complete proteome; Reference proteome OX=1736223 OS=Serratia sp. Leaf50. GN=ASE93_05975 OC=Yersiniaceae; Serratia.
Sequence
MQEGKTRKTSSLSILAIAGVEPYQEKPGEEYMNGAQLDHFKKILEAWRNQLRDEVDRTVT
HMQEEAANFPDPADRATQEEEFSLELRNRDRERKLIKKIEKTLKKVEDEDFGYCESCGVE
IGIRRLEARPTADLCIDCKTLAEIREKQMAG
Download sequence
Identical sequences A0A0Q4MPS0 A0A1X0W3G6
WP_055775014.1.97414 WP_055775014.1.97913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]