SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q4NTY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q4NTY7
Domain Number 1 Region: 10-106
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 1.44e-27
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.00035
Further Details:      
 
Domain Number 2 Region: 107-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000299
Family Prokaryotic DksA/TraR C4-type zinc finger 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q4NTY7
Sequence length 147
Comment (tr|A0A0Q4NTY7|A0A0Q4NTY7_9BURK) RNA polymerase-binding transcription factor DksA {ECO:0000256|HAMAP-Rule:MF_00926} KW=Complete proteome OX=1736227 OS=Duganella sp. Leaf61. GN=ASF04_16765 OC=Oxalobacteraceae; Duganella.
Sequence
MTTKTNKSTAAERILTEEEILKMDEKDYMNPAQMAFFKAKLQQLEKELLKNAGETTEHLR
ETVLVPDPADRATIEEEHALELRTRDRERKLLKKVQQSIVAIDGGDYGWCEETGEPIGIP
RLIARPTATLSLEAQQRRELKQKLYGD
Download sequence
Identical sequences A0A0Q4NTY7 A0A1E7X5S4
WP_019924723.1.60814 WP_019924723.1.87671 WP_019924723.1.89411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]