SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q5BEJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q5BEJ2
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily Transthyretin (synonym: prealbumin) 3.53e-38
Family Transthyretin (synonym: prealbumin) 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q5BEJ2
Sequence length 113
Comment (tr|A0A0Q5BEJ2|A0A0Q5BEJ2_9MICO) 5-hydroxyisourate hydrolase {ECO:0000256|RuleBase:RU361270} KW=Complete proteome; Reference proteome OX=1736327 OS=Rathayibacter sp. Leaf296. GN=ASF46_07485 OC=Rathayibacter.
Sequence
MSAHASHVTTHVLDAVRGRPAEGVPVVLEARADSAWERLADARTDADGRVSAFGPEALPA
GVYRVVFDTAAYFGDVESFYPEVVIAFRLADEGAHYHVPLLLSPFAYSTYRGS
Download sequence
Identical sequences A0A0Q5BEJ2
WP_056866977.1.2192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]