SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q5TJA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q5TJA8
Domain Number 1 Region: 7-182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.6e-39
Family G proteins 0.0000253
Further Details:      
 
Domain Number 2 Region: 184-222
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000196
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q5TJA8
Sequence length 255
Comment (tr|A0A0Q5TJA8|A0A0Q5TJA8_DROER) Uncharacterized protein, isoform B {ECO:0000313|EMBL:KQS30443.1} KW=Complete proteome OX=7220 OS=Drosophila erecta (Fruit fly). GN=Dere_GG19552 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNAYKTTTILLEGKRVKL
QLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPGIPKVLVG
NRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCDFNIRESFCELARMALHRNGMEHIWR
SNKVLSLQELCCRTIVRRTSVYAIDSLPLPPSVKSTLKSYALTTSQCFNSLTQSSKSKNR
CKTPTSSSRNSCAIA
Download sequence
Identical sequences A0A0Q5TJA8 B4Q1M5
XP_002100358.2.41174 XP_015011351.1.56816 XP_016039087.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]