SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0Q5WBT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q5WBT8
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 5.49e-39
Family MIR domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1086-1216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-20
Family SPRY domain 0.027
Further Details:      
 
Domain Number 3 Region: 665-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000435
Family SPRY domain 0.061
Further Details:      
 
Domain Number 4 Region: 98-182
Classification Level Classification E-value
Superfamily MIR domain 0.000000209
Family MIR domain 0.025
Further Details:      
 
Domain Number 5 Region: 4210-4272
Classification Level Classification E-value
Superfamily EF-hand 0.000000476
Family Calmodulin-like 0.032
Further Details:      
 
Domain Number 6 Region: 2251-2349
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000589
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q5WBT8
Sequence length 5130
Comment (tr|A0A0Q5WBT8|A0A0Q5WBT8_DROER) Uncharacterized protein, isoform F {ECO:0000313|EMBL:KQS70838.1} KW=Complete proteome OX=7220 OS=Drosophila erecta (Fruit fly). GN=Dere_GG23389 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAEAEGGSEQDDVSFLRTEDMVTLSCTATGERVCLAAEGFGNRHCFLENIADKNVPPDLS
QCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTS
SSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NEQSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAG
QNIVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDSNELIL
VKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLWLSYK
SYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITALE
TLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEE
GVLNLILEAIDKINIITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQF
ANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGS
SMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFD
GAYLWTGGRRTLVVDALPEEPFIRKGDVVGVAIDLSVPIITFTFNGVKVRGSFRDFNLDG
MFFPVMSCSSKLSCRFLFGGDHGRLKFAPPMGFSALVQCLMPQQILSLDPCFYFGNLSKN
VLAGPWLIEDDNAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHR
DDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIRPVRLPNEI
FMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRS
PHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEAQRLKFAGFRT
YRVERNYAVTSGKWYFEFEVLTSGPMRVGWARADCYPGAMLGSEDTSWAFDGHNEEKVYG
GVSESFGKQCGPGDIVGVFLDLADHTISFSLNGELLMDALGGETTFADVTAEGVGFVPAC
TLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMP
DCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMSEFIGEQEKARRWD
EIKNRQYRLMREAEIAAQMQVQTQAAHMDHMLKGGFNMNDIKGLTRNFDEHADAEADHIM
RGPNRPPRKGSLTRNITFETDMSAALDEMQRSTSVLDMNGLGEEMDDKKKRGRSPFKFFS
KKSRDQSREKMGARTLDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNAEIPPSPVPQGP
KQLSGSNLGQQPVETSGDEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHLHS
REFNKNKVRRGSVYIEDDYEMAIERIDRQSCYVVRADELFNEVTQDASGKGASQGMFVGC
FVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLSAA
VLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDVRGWSMLCEDPVSMLA
LHIPEEDRCIDILELIEMDKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQLLYAI
RSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGAELKELYSEEEMQHSLRSL
VTESVRPQLRMTEITPPVIATSSMPSVSSEPIPDIDQLYSPKFPLEVVRQFVMEALKDAV
EINQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQRLLVMIDPETWDQAFEREG
KDEHRKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYI
EIKQSDLPSAVAAKKTKEFRCPPREQMNQILCFKNLEADDQDNCTCGLELRGRLGDFHDS
LMQKVSLNALQEPDGVEGTAIEEIKTGPITKIYNFINTVKELEEGPKEVEEPEKKTPEEV
FRKVLIKTIVSWAEESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINTRAREDVA
EMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMN
TLGRRAQAQSDAPTQPEGAEGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFD
FLLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSE
LVEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEG
EGLFRAIVEANRMSERISDRCKMQDEAEGTIAGLNFTHPLPEGEEDEDYIDTGAAILNFY
CTLVDLLGRCAPDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKFTLSQTAPGEEKP
KSDMPSGLLPNNKQSIVLFLERVYGIEAQDLFYRLLEDAFLPDLRTATILDKSDGSESDM
ALAMNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDF
LVALTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGA
SSDEEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKNTDEDYYG
RQMGAPDQPQYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDN
DRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVPLNHRGSTRRQSKP
QINEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIHPQL
VPYDLLTDKEKKKDRERSQEFLKYMQYQGYKLHKPSKGGAVEEGGATQAAVELRFSYSLL
EKLIQYLDRATINMKLLKPSTTFSRRSSFKTATRDIKFFSKVVLPLMEKYFSTHRNYFIA
IATATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGIDARTL
TKNCPEFIRTSMLTFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYVNQVVLPVL
TAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLKTEIERHRPALG
SCLGAYSSCFPVAFLEPHLNKHNQYSLLNRIADHSLEAQDIMVKMESCMPNLETILAEVD
QFVESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNHVTMVTADHMNPLLRN
VLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLHKEDS
MRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEAEELY
NHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPTATRRSAISEGAPAVGGKVKKKK
KNRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYLKKMPEYDVIEF
ARNQLTLPDKLDPSDEMSWQHYLYSKLGKTEEPVDEQALEKANVNSNEKGKDKTQETVDR
IVAMAKVLFGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHRACNIFAR
TYHEQWLQEENVGQEVMVEDLTQTFEDSEKSKKEGEETDSKPDPLTQLVTTFCRGAMTER
SGALQEDLLYMSYAQIAAKSTGKEEEEGGDEEGGEGGEEGEGTSIHCRMRQLMEQEMEKQ
KLLFHQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLK
EKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEFTCALFRF
IQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAG
KANFFKAIEVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHS
SQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLK
LADLIESPSFHEVDMKNEGWVTPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRA
FVEHFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSS
KRIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTH
ASGLMATDDGGGNVKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPANI
KHQIGVMQTKSIPELIVGFFKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGPAPEQEEEP
VVEEETFGRALPPLPLEEPPGTVQAFGLDINKEDNGMYKVVVHESPANSSMEEGGESSPE
DGTAPSGELVEGEPHQEPISIVDLLGGEAAKKAAQERQEAQKAQEAAMASIEAEAKKSSS
APQETPAVHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSFTEEADS
SAEEELILGSGSGGGADITGSGFGGSGDGGSGDGEMEDEIPELVHVDEDFFYMEHVLRIA
ACLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFEGLFIAEQPEDDDFKSHWDKLVI
SAKSFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKSTFAAQESEETGIFKYIMNID
WRYQVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTH
NGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRA
GGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKDN
MESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNM
YQQRSWDFFPVGDCFRKQYEDELSGGGGGG
Download sequence
Identical sequences A0A0Q5WBT8
XP_015014783.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]