SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q6HYS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q6HYS3
Domain Number 1 Region: 17-145
Classification Level Classification E-value
Superfamily YojJ-like 1.27e-29
Family YojJ-like 0.0025
Further Details:      
 
Domain Number 2 Region: 279-354
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000000556
Family NAD+-dependent DNA ligase, domain 3 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q6HYS3
Sequence length 359
Comment (tr|A0A0Q6HYS3|A0A0Q6HYS3_9BACI) Diadenylate cyclase {ECO:0000256|HAMAP-Rule:MF_01438} KW=Complete proteome OX=1736235 OS=Bacillus sp. Leaf75. GN=ASG61_24710 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MEGEKTTVSQKQISEILQFVAPGTPIRDGIDNVLRAKTGGLIVMGYNEQVKKMVDGGFSI
NCAFTPAHLYELAKMDGALILNDSGSKILFANAQLMPDPSTPSSQTGMRHRTAERVAKQS
GVLVIAISQRRNVITLYKGSLQYVLKDISVILAKANQALGTLEKYKAVLDESITSLSALE
FEEQVTHTDVLQSLHRTEMVLRIKNEILSYISELGTEGRLIRLQMNELLSHLEEEATLLI
KDYMYDLSFDPYRVIERMQQPSNNVLLDDQTLLRLMGYPMYTSFEDSVIPRGYRMLHKIP
RLPSIIIENLIDELGDLKTIADASVEELDEVEGIGEIRARKIREGLKRLKEQHLTNRQL
Download sequence
Identical sequences A0A0B6AR56 A0A0H4R7U4 A0A0J6PD79 A0A0L1LQT9 A0A0M0WU01 A0A0Q6HYS3 A0A0Q9FKL8 A0A0Q9HQ99 A0A0Q9UM79 A0A120EBR3 A0A1G7EYA4 D5D997 D5DVQ7 G2RS33
gi|384049295|ref|YP_005497312.1| gi|294496956|ref|YP_003560656.1| WP_013054900.1.100032 WP_013054900.1.11259 WP_013054900.1.12495 WP_013054900.1.12923 WP_013054900.1.15866 WP_013054900.1.17588 WP_013054900.1.18762 WP_013054900.1.22068 WP_013054900.1.30509 WP_013054900.1.31602 WP_013054900.1.43466 WP_013054900.1.44691 WP_013054900.1.47795 WP_013054900.1.53165 WP_013054900.1.54970 WP_013054900.1.56431 WP_013054900.1.56574 WP_013054900.1.58922 WP_013054900.1.61351 WP_013054900.1.62029 WP_013054900.1.64554 WP_013054900.1.6542 WP_013054900.1.65684 WP_013054900.1.71276 WP_013054900.1.73947 WP_013054900.1.76027 WP_013054900.1.77219 WP_013054900.1.77638 WP_013054900.1.80264 WP_013054900.1.82953 WP_013054900.1.90160 WP_013054900.1.9085 WP_013054900.1.91935 WP_013054900.1.92059 WP_013054900.1.9244 WP_013054900.1.94149 WP_013054900.1.95734 WP_013054900.1.96672 gi|295702323|ref|YP_003595398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]