SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q6I709 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0Q6I709
Domain Number - Region: 29-94
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 0.0114
Family Arp2/3 complex 16 kDa subunit ARPC5 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q6I709
Sequence length 130
Comment (tr|A0A0Q6I709|A0A0Q6I709_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KQU24838.1} KW=Complete proteome OX=1736235 OS=Bacillus sp. Leaf75. GN=ASG61_19570 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKIAQAAPPEMENYIEELTEQLRYDLLPRYVSVDKLNPDELLNPDYCTDHLYNGLLDEAL
QVISSLQTIIAVIEAIQHRPIEESDCEQFEKNISILKKYGFLFPVSIECFAKENNLITYS
YESFYNSYIN
Download sequence
Identical sequences A0A0M0WG51 A0A0Q6I709 A0A0Q9UWY7 A0A2A9YF82 D5DYU0
gi|294497316|ref|YP_003561016.1| WP_013055257.1.100032 WP_013055257.1.12495 WP_013055257.1.17588 WP_013055257.1.53165 WP_013055257.1.64554 WP_013055257.1.77219 WP_013055257.1.82953 WP_013055257.1.9085 WP_013055257.1.9244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]