SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q7E2M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q7E2M0
Domain Number 1 Region: 102-163
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.000000047
Family Crystallins/Ca-binding development proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q7E2M0
Sequence length 182
Comment (tr|A0A0Q7E2M0|A0A0Q7E2M0_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:KQW77033.1} KW=Complete proteome; Reference proteome OX=1736531 OS=Devosia sp. Root413D1. GN=ASC89_17645 OC=Hyphomicrobiaceae; Devosia.
Sequence
MLAAGLGAVPQVLAQETFVIVPDNPGGGSGVGNAVATSNVNVRRGPGTSYAVVDVLRAGQ
SVRISNCSGGWCWVNHGGPSGWVSQNFLSRTGSGGGDSNVRRRACFYDDIRFRGRSFCVG
VGDSNRDLGSWNNRIASISISGSMTVKVCEDRNFRRCEDFNRDVATLPWWLDGNISSFRT
FR
Download sequence
Identical sequences A0A0Q7E2M0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]