SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q7LRZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q7LRZ5
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily YajQ-like 6.8e-28
Family YajQ-like 0.00046
Further Details:      
 
Domain Number 2 Region: 89-161
Classification Level Classification E-value
Superfamily YajQ-like 1.8e-27
Family YajQ-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q7LRZ5
Sequence length 161
Comment (tr|A0A0Q7LRZ5|A0A0Q7LRZ5_9BURK) UPF0234 protein ASD34_00670 {ECO:0000256|HAMAP-Rule:MF_00632} KW=Complete proteome; Reference proteome OX=1736541 OS=Variovorax sp. Root473. GN=ASD34_00670 OC=Comamonadaceae; Variovorax.
Sequence
MPSFDTVCEPNLPEVKNAVENTAKEIGTRFDFKGTAAAVELKDKEITMIGDAEFQLVQVE
DILRNKLTKRSVDVRFLDKGDVQKMGGDKVKQVIKIKNGIETEQAKKITRIIKDSKLKVQ
AAIQGDAVRITGAKRDDLQAAMALIKKDVPDMPLSFNNFRD
Download sequence
Identical sequences A0A0Q7LRZ5
WP_056571702.1.81076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]