SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q8BE62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q8BE62
Domain Number 1 Region: 45-156
Classification Level Classification E-value
Superfamily NosL/MerB-like 1.39e-37
Family NosL-like 0.0000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q8BE62
Sequence length 172
Comment (tr|A0A0Q8BE62|A0A0Q8BE62_9RHIZ) Copper resistance protein CopZ {ECO:0000313|EMBL:KQZ99865.1} KW=Complete proteome; Reference proteome OX=1736477 OS=Mesorhizobium sp. Root157. GN=ASD64_13690 OC=Phyllobacteriaceae; Mesorhizobium.
Sequence
MVLAGLLALGACQRQAEAPPPPFAMTEDAMGRYCGMNILEHAGPKGQIILAKYDEPIWFS
SARDAIAFTMLPEEPKDIRAIYVSDMAKAPTWDEPGADNWVDARQAFFVIGSNRKGGMGA
AEAAPFSTEEAATAFAGAHGGEVVRFDAVPRDYILEQQTGANGAPAPSREVH
Download sequence
Identical sequences A0A0Q8BE62

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]