SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q8EKF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q8EKF5
Domain Number 1 Region: 79-121
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.000000000000349
Family H-NS histone-like proteins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q8EKF5
Sequence length 123
Comment (tr|A0A0Q8EKF5|A0A0Q8EKF5_9GAMM) DNA-binding protein {ECO:0000313|EMBL:KRA46654.1} KW=Complete proteome; Reference proteome OX=1736574 OS=Pseudoxanthomonas sp. Root630. GN=ASD72_05550 OC=Xanthomonadaceae; Pseudoxanthomonas.
Sequence
MSIDLRNLSAKELGALIAKAKEQQTKLAKRTPIATVRGKITKFAKAEGYTLEELFGTPGR
AAAKTTAKPAASRAGRKLGKVAPKYRNPANPKETWTGRGKHPRWMAALIAKGKKAEDFLI
KKK
Download sequence
Identical sequences A0A0Q8EKF5
WP_056879533.1.8670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]