SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q8GFL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q8GFL3
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily Transthyretin (synonym: prealbumin) 5.49e-41
Family Transthyretin (synonym: prealbumin) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q8GFL3
Sequence length 117
Comment (tr|A0A0Q8GFL3|A0A0Q8GFL3_9BURK) 5-hydroxyisourate hydrolase {ECO:0000256|RuleBase:RU361270} KW=Complete proteome OX=1736580 OS=Pelomonas sp. Root662. GN=ASD88_19635 OC=Comamonadaceae; Pelomonas.
Sequence
MGKLTTHVLDTANGCPAAGMAVRLYRFDAEGPKWLRSLHLNADGRADGPLLDGATFTAGR
YRLVFEVAAYFRGRGEKLPEPVFLDEVPLDFGIADESSHYHVPLLASPWSYSTYRGS
Download sequence
Identical sequences A0A0Q7ARP5 A0A0Q8GFL3
WP_056271955.1.38204 WP_056271955.1.51473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]