SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q9PIT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q9PIT1
Domain Number 1 Region: 10-119
Classification Level Classification E-value
Superfamily FlgN-like 3.66e-21
Family FlgN-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9PIT1
Sequence length 147
Comment (tr|A0A0Q9PIT1|A0A0Q9PIT1_9GAMM) Flagellar biosynthesis protein FlgN {ECO:0000313|EMBL:KRE90890.1} KW=Complete proteome; Reference proteome OX=1736407 OS=Frateuria sp. Soil773. GN=ASG87_01765 OC=Rhodanobacteraceae; Frateuria.
Sequence
MNRQLQTELDAALTAVVEDIRRAADELARVLEAERDALASADAAALDRIGSHKQQLMQQL
EQYDAERVQLSEALPAAALLATRWQEVLQTLANCRQLNQRNGSLVAQRLEQVRRALAVLT
GQPGDAELYGPSGELRARPRSQQLAQA
Download sequence
Identical sequences A0A0Q9PIT1
WP_056004711.1.55340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]