SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q9S7X4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q9S7X4
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily TIMP-like 0.000000487
Family Tissue inhibitor of metalloproteinases, TIMP 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9S7X4
Sequence length 198
Comment (tr|A0A0Q9S7X4|A0A0Q9S7X4_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KRF20265.1} KW=Complete proteome OX=1736412 OS=Nocardioides sp. Soil796. GN=ASH02_21305 OC=Nocardioides.
Sequence
MRRLMVLVLLALGWVALSPATAYACDTPAPQRPQQLKQATAVFTGTVSQVTASPADAGVT
TLYVVKVDRVYKGARVTSEVTVSSPTKRDKCGLVGVRKGSRYLFVARSVTGADFQARSWQ
GTQAISPEVRADVEGVLGKGTLPADQQTTPEETEVTTQRVDDSAPPGATKAVAPGLLLAL
IGGVVLVLARFLGRSRRA
Download sequence
Identical sequences A0A0Q9S7X4
WP_056684532.1.17024 WP_056684532.1.22901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]