SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0Q9UWX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0Q9UWX5
Domain Number - Region: 468-497
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0233
Family FIS-like 0.036
Further Details:      
 
Domain Number - Region: 384-439
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0915
Family Capz alpha-1 subunit 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9UWX5
Sequence length 527
Comment (tr|A0A0Q9UWX5|A0A0Q9UWX5_9BACI) Transcriptional regulator {ECO:0000313|EMBL:KRF56447.1} KW=Complete proteome OX=1736389 OS=Bacillus sp. Soil531. GN=ASG98_05255 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MELQTLLRIPIYEKASVVAGQKGVTRKVHNVNMMDAPDILSFLKEGEFLITTGYHFKEHE
ESLAKLVEGMAKKKCAGLAIKTKRFFEHVPASICQLADELHFPIIDFQTDETLGAVINES
LSFILDKKTAELQQAMVTHQLFSSYILQGKGIEKIMQSIQTLCNAHVALFDTHGHELFYT
NKREPFSLPMEEAVAGAKQLFLRTSKYTTFSFLHTKKTVTLFPIATHTRKYSYLLIEHQV
SLSDSALLTIEQATNVLSFEMMRQQALYEAERRRKNDFFNQLVNNYYKTLEDASFQAQMM
GLSAGNSYICAVGKIHSTFTPYSDDDMIYELLQYELSTGHTEAVLFFYDNLYILLFTPHS
QPMIIECLHRLQEAVYRHYDKRMSFGVGNQSQSLLTIADSYKEAVEALETIHFKDQSKLI
QFYQPKQFKELLRLLPANDLQDYYSQTLEGLLQYDKKDRSILLDTLETYLNSNCQISETA
KQLFVHRNTVIYRIEKCEELLKRPIHTSEETLRLRVAFQIFSLVHAN
Download sequence
Identical sequences A0A0Q6I2P3 A0A0Q9UWX5 A0A2C0KI79 D5DW66
gi|294499764|ref|YP_003563464.1| WP_013057705.1.53165 WP_013057705.1.64554 WP_013057705.1.82953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]