SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q9UXR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q9UXR6
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily YajQ-like 2.46e-28
Family YajQ-like 0.0005
Further Details:      
 
Domain Number 2 Region: 92-163
Classification Level Classification E-value
Superfamily YajQ-like 1.96e-25
Family YajQ-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9UXR6
Sequence length 163
Comment (tr|A0A0Q9UXR6|A0A0Q9UXR6_9BACI) UPF0234 protein ASG98_19140 {ECO:0000256|HAMAP-Rule:MF_00632} KW=Complete proteome OX=1736389 OS=Bacillus sp. Soil531. GN=ASG98_19140 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MAKDSSFDIVSQVDLSEVTNGITMATKEIKTRYDFKGSKSEISLENEELVLISDDEFKLE
QLKDVLISKLIKRGVPTRNISYGKIENASGGTVRQRAKLIQGIDKDNAKKLNTIIKNTGL
KVKSQIQDDQLRVSGKNRDDLQQIISAIRSADLPIDVQFINYR
Download sequence
Identical sequences A0A0B6AL62 A0A0L1LS70 A0A0M0WGW0 A0A0Q6I519 A0A0Q9FW50 A0A0Q9HYQ9 A0A0Q9UXR6 A0A120EES3 A0A1S2CB90 D5DAF3 D5DZY1
WP_013055376.1.100032 WP_013055376.1.11259 WP_013055376.1.12495 WP_013055376.1.12923 WP_013055376.1.15866 WP_013055376.1.17588 WP_013055376.1.18762 WP_013055376.1.30509 WP_013055376.1.44691 WP_013055376.1.53165 WP_013055376.1.54970 WP_013055376.1.56574 WP_013055376.1.58922 WP_013055376.1.61351 WP_013055376.1.64554 WP_013055376.1.6542 WP_013055376.1.65684 WP_013055376.1.71276 WP_013055376.1.73947 WP_013055376.1.77219 WP_013055376.1.77638 WP_013055376.1.80264 WP_013055376.1.82953 WP_013055376.1.9085 WP_013055376.1.91935 WP_013055376.1.92059 WP_013055376.1.9244 WP_013055376.1.94149 gi|295702807|ref|YP_003595882.1| gi|294497435|ref|YP_003561135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]