SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0Q9WHJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q9WHJ7
Domain Number 1 Region: 242-450
Classification Level Classification E-value
Superfamily MIR domain 7.32e-58
Family MIR domain 0.000000193
Further Details:      
 
Domain Number 2 Region: 451-621
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.18e-52
Family IP3 receptor type 1 binding core, domain 2 0.000000688
Further Details:      
 
Domain Number 3 Region: 1209-1357
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 9.15e-36
Family IP3 receptor type 1 binding core, domain 2 0.0087
Further Details:      
 
Domain Number 4 Region: 111-218
Classification Level Classification E-value
Superfamily MIR domain 0.00000000000012
Family MIR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9WHJ7
Sequence length 2826
Comment (tr|A0A0Q9WHJ7|A0A0Q9WHJ7_DROVI) Uncharacterized protein, isoform D {ECO:0000313|EMBL:KRF83698.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ22702 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MGDNIIGSASFLHLGDIVSLYAEGSVCGFLSTLGLVDDRTVVCPEAGDLSCPPKKFRDCL
IKICPMNRYSAQKQFWKAAKQSASSNTDPNLLKRLHHAAEIEKKQNETENKKLLGTFIQY
GRAVVQLLHLKSNKYLTVNKRLPSLLEKNAMRVYLDANGNEGSWFYIKPFYKLRSIGDYV
VVGDKVILSPVNADQQNLHVAANYELPDNPGCKEVNVLNSSTSWKISLFMEHKENQEHIL
KGGDVVRLFHAEQEKFLTMDEYKKQYHVFLRTTGRTSATAATSSKALWEIEVVQHDSCRG
GAGDWNSLYRFKHLATGHYLAAESESDVAAGTVAANAHESLLGDCSKDSGLSSTMNSTLN
EKPKGKLYRLVSVPYSADIASVFVLDATTMARPDSLVPQSSYVRLQHICSNTWVHATSIP
IDVDDDKPVMSKVCCSPIKEDKEAFALIPVSPVEVRDLDFANDACKVLAMVTSKLDNGSI
SINERRALISLLQDIVYFIAGMENEQNKTKALEFTIKNPIRDRQKLLREQYILKQLFKIL
HGPFQEHSAGDGPFLRLDELSDPKNAPYKNIFRLCYRILRLSQQDYRKNQEYIAKHFGLM
QKQIGYDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKNMHNWDSRFLDYLSDLC
VSNRKAIAVTQELICKSVLSDKNVDILIDTQIKALRGDAAVRCYKGASEDVCLATLTEVA
GDDEDRSDLQSNSTTSTWDSASLNGEAEKYEIHLQWKGQPSSRSMADLASSVADGCEQEA
AILNYYRHQLNLFSNMCLNRQYLALNRLSPQLDIDLILKCMSDETMPYELRASFCRLMLH
MHVDRDPQEPVTPVKYARLWSEIPSKMSIMDYDGKNLQPDQNKQACRAKFNTTIAFVENY
LCNVATKVWLFTDQEQNKLTFEVVKLARDLIYFGFYSFSDLLRLTKTLLSILDCVSETSS
GGGYVNADIESEGGVLRSIGDMSTVMTSLALGSVGQAIAAPAIALQQRKSVSQLMKEYPL
VMDTKLKIIEILQFILDVRLDYRISCLLSIFKREFDESEVLAQTQTGPNEEQTPPATAGT
TDSEQIAAAEAAMAAAAAAATAAAARQKNIDLESIGVQAEGIFDCERSDAANLDLDGQGG
RTFLRVLLHLIMHDYAPLVSGALHLLFRHFSQRQEVLQAFRQVQLLVSDSDVESYKQIKS
DLDILRQSVEKSELWVYKAKATDELGVSEVAGGADSLEYDATLSPEQRGEYQKVKEILIR
MNKFCVTAGPIVRPRKHEQRLLRNVGVHTVVLDLLQNPYDEKDDVLMKELMCLAHEFLQN
FCLGNQQNQVLLHNHLDLFLNPGILEAKTVCAIFKDNLALCNEVTDKVVQHFVHCIEIHG
RHVAYLQFLQTIVKAENQFIRKCQDMVMQELINAGEDVLVFYNDKTSFQHFVQMMQQQQQ
RRQPLSDDSPLKYHVELVKLLACCTMGKNVYTEIKCNNLLSLDDIVTIICHPLCMPEVKE
AYVDFLNHCYIDTEVEMKEIYASGHMWSLFEKSFLVDLNLLVSNSTAAANKTLLAYVLNG
VTNLLGSFFSSPFSDQSTIVQSRQLIFVQLLQATYRLTQCKWLPLADRFNVETCIRTLTE
SAKMRSIVLPVELEQQVANMSSKTAMLTRQTAKWLLASKQPKYETQQSAQLMRWDRSIIE
GLQDIVSLLEDQLKPVVEAELSLLVDILYRSELLFPAGTEARKRCESGGFIRKLIKHTEK
LLEEKEERMCVKVLRTLREMMAIDVNYGEKGDALRETLLLRYFQCKSAPKLEDEHPHLPA
AMAAAAAVAAAAATSDSAKQLHLVTHGPGAKYLARAGKTLHEMQNHLDREGASDLVVELV
IKSVHSPNIFVEAVELGIALLEGGNPIIQKGMFQKFLSDDLNQAFFKVFFEKMKDAQQEI
KSTVSVNTTDIAAKAHEHKQDGNLELDKISRKHGLKSNGVVITDELKRELHNAGLATARA
YGNARNIHSGEESSAISVNSPLEDILAEKLEKHRDSKEQRNQLSNKVLVMQPILRFLQLL
CENHNPDLQNLLRNQNNKTNNNLVSETLMFLDCICGSTTGGLGLLGLYINEHNVALINQT
LETLTEYCQGPCHENQNCIATHESNGLDIITALILNNINPLGENRMDLVLELKNNASKLL
LAIMESRGDSENAERILYNMNPKQLVEVACKAYHQEELIDEQDDADEPSAATDDDDATVS
PREVGHNIYILCHQLAQHNKELAALLKASEDPQSASFDAKTSQALMYYATHTAQIEIVRN
DRTLEQIVFPIPEICEYLTTDTKIKILNTAERDDQGSKVADFFDKAEEMFNEMKWQKKLR
SQPLLFWISSYMSLWSNILFNCVVVINMIVAFFYPFDNTVPELSSHISLLFWAILIFSLV
IVITLPRESGIRTFIGSVILRFIFMLGPESTLCLLGVVTVTLKSVHIVSIMGNKGTLEKH
FLKIITDFQLLYHCIYIAFCFCGLIFHPFFYSLLLFDVVYREETLVNVIRSVTRNGRSIV
LTAVLALILVYLFSIIGYMFFKDDFLVPVDFEEQEAASTIGPLTLSVPASPEESCAMPDE
LGVCNGGTKQQVAAAAAGSGEAKERSCDSLVMCIVTTLNQGLRNGGGIGDILRAPSSKEG
LFVARVIYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKEAILKTTCFICSLNRSAF
DNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKAGILEWFPRLRAM
SLAAVDADGEQIELRSMQAQLLETQLLIKNLSTQLHELKDHMTEQRKQKQRLGLLNTTAN
CLLPFQ
Download sequence
Identical sequences A0A0Q9WHJ7
XP_015026882.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]