SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0Q9WZX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q9WZX8
Domain Number 1 Region: 242-450
Classification Level Classification E-value
Superfamily MIR domain 6.93e-59
Family MIR domain 0.0000002
Further Details:      
 
Domain Number 2 Region: 451-621
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.27e-53
Family IP3 receptor type 1 binding core, domain 2 0.000000643
Further Details:      
 
Domain Number 3 Region: 1216-1365
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.48e-37
Family IP3 receptor type 1 binding core, domain 2 0.0079
Further Details:      
 
Domain Number 4 Region: 111-218
Classification Level Classification E-value
Superfamily MIR domain 0.00000000000012
Family MIR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9WZX8
Sequence length 2834
Comment (tr|A0A0Q9WZX8|A0A0Q9WZX8_DROMO) Uncharacterized protein, isoform D {ECO:0000313|EMBL:KRG01253.1} KW=Complete proteome; Reference proteome OX=7230 OS=Drosophila mojavensis (Fruit fly). GN=Dmoj_GI23082 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MGDNIIGSASFLHLGDIVSLYAEGSVCGFLSTLGLVDDRTVVCPEAGDLSCPPKKFRDCL
IKICPMNRYSAQKQFWKAAKQSASSNTDPNLLKRLHHAAEIEKKQNETENKKLLGTFIQY
GRAVVQLLHLKSNKYLTVNKRLPSLLEKNAMRVYLDANGNEGSWFYIKPFYKLRSIGDYV
VVGDKVILSPVNADQQNLHVAANYELPDNPGCKEVNVLNSSTSWKISLFMEHKENQEHIL
KGGDVVRLFHAEQEKFLTMDEYKKQYHVFLRTTGRTSATAATSSKALWEIEVVQHDSCRG
GAGDWNSLYRFKHLATGHYLAAEAESDVVAGTNAANGHESLLGDCSKDSGLSSTMNSTLN
DKPKGKLYRLVSVPYSADIASVFVLDATTMARPDSLVPQSSYVRLQHICSNTWVHATSIP
IDADDDKPVMSKVCCSPIKEDKEAFALIPVSPVEVRDLDFANDACKVLAMVTSKLDNGSI
SINERRALISLLQDIVYFIAGMENEQNKTKALEFTIKNPIRDRQKLLREQYILKQLFKIL
QGPFQEHSAGDGPFLRLDELSDPKNAPYKNIFRLCYRILRLSQQDYRKNQEYIAKHFGLM
QKQIGYDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKNMNNWDSRFLDYLSDLC
VSNRKAIAVTQELICKSVLSDKNVDILIDTQVKALRGGNSVRCYKGASEDVCLSTLTEVA
GDDEDRSDVQSTSTSTTWDSASLNDDESVLPGEKYEIHLQWKGQPSSRSMADLANCVAEG
CEQETAILNYYRHQLNLFSNMCLNRQYLALNRLSPQLDIDLILKCMSDETMPYELRASFC
RLMLHLHVDRDPQEPVTPVKYARLWSEIPSKMSIMDYDGKNLQPDQNKQACRAKFNTTIA
FVENYLCNVATKVWLFTDQEQNKLTFEVVKLARDLIYFGFYSFSDLLRLTKTLLSILDCV
SETTTGGSFVNTDIDSEGGVLRSIGDMSTVMTSLALGSVGQAIAAPSIALQQRKSVSQLM
KEYPLVMDTKLKIIEILQFILDVRLDYRISCLLSIFKREFDESEVVTQAPPTGANEEQNQ
QTTPGSTGTTDAEQIAAAEAAMAAAAAASAAAARQKNIDLESIGIQAEGIFDCERSDAAN
LDLDGQGGRTFLRVLLHLIMHDYAPLVSGALHLLFRHFSQRQEVLQAFRQVQLLVSDSDV
ESYKQIKSDLDILRQSVEKSELWVYKAKATDELGGTDAAGGADNLEYDATLSPEQRSEYQ
KVKEILIRMNKFCVTDGPIVKPRKHEQRLLRNVGVHTVVLDLLQNPYDEKDDVLMKELMC
LAHEFLQNFCLGNQQNQVLLHNHLDLFLNPGILEAKTVCAIFKDNLALCNEVTDKVVQHF
VHCIEIHGRHVAYLQFLQTIVKAENQFIRKCQDMVMQELINAGEDVLVFYNDKTSFHHFV
QMMQQQQQQRGQQLRDDSPLKYHVELVKLLACCTMGKNVYTEIKCNNLLSLDDIVTIICH
PLCIPEVKEAYVDFLNHCYIDTEVEMKEIYASGHMWSLFEKSFLVDLNLLISNTSATANK
TLLAYVLNGVTNLLSSFFSSPFSDQSTIVQSRQVIFVQLLQAVYRLTQCKWLSLADRFNV
ENCIRTLTESAKMRSIVLPLELEQQVTNMSSKTAMLTRQTTKWLLASKQPKYDTQQSAHL
MRWDRSIIEGLQDIVSLLEDQLKPVVEAELSLLVDILYRSELLFPAGTEARKRCESGGFI
RKLIKHTEKLLEEKEERMCVKVLRTLREMMAIDVNYGEKGDALRQTLLLRYFQCKSAPKL
EEEHPQLPTGVAAAAALAAAAASDPAKQLHLVTHGPGAKYLARADKTLHEMQNHLDREGA
SDLVVELVIKSVHSPNIFVEAVELGIALLEGGNPIIQKGMFQKFLSDDLNQAFFKVFFEK
MKDAQQEIKSTVSVNTTDIAAKAHEHKQDTNMELDKISRKHGLKSNGVVITDELKRELHN
AGLATARAYGNARNIHSGEESSAISVNSPLEDILAEKLEKHRDSKEQRNQLSNKVLVMQP
ILRFLQLLCENHNPDLQNLLRNQNNKTNNNLVSETLMFLDCICGSTTGGLGLLGLYINEH
NVALINQTLETLTEYCQGPCHENQNCIATHESNGLDIITALILNNINPLGENRMDLVLEL
KNNASKLLLAIMESRGDSENAERILYNMNPKQLVEVACKAYHQEELIDEQDDGDEPSAAT
DDDDATVSPREVGHNIYILCHQLAQHNKELAALLKASEDPQSASFDAKTSQALMYYATHT
AQIEIVRNDRTLEQIVFPIPEICEYLTTDTKIKILNTAERDDQGSKVADFFDKAEEMFNE
MKWQKKLRSQPLLFWISSYMSLWSNILFNCVVVINMIVAFFYPFDNTVPELSSHISLLFW
AILIFSLIIVITLPRESGIRTFIGSVILRFIFVLGPESTLCLLGVVTVTLKSVHIVSIMG
NKGTLEKHFLKIITDFQLLYHCIYIAFCFCGLIFHPFFYSLLLFDVVYREETLVNVIRSV
TRNGRSIVLTAVLALILVYLFSIIGYMFFKDDFLVPVDYEEQEAGSAAGPLTLSVPASAD
QFCAMPDEHGSCEGSTKQNGPATVIASGEVKERSCDSLVMCIVTTLNQGLRNGGGIGDIL
RAPSSKEGLFVARVIYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKEAILKTTCFI
CSLNRSAFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKAGILE
WFPRLRAMSLAAVDADGEQIELRSMQAQLLETQLLIKNLSTQLHELKDHMTEQRKQKQRL
GLLNTTANCLLPFQ
Download sequence
Identical sequences A0A0Q9WZX8
XP_015022359.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]