SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R0CVF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R0CVF2
Domain Number 1 Region: 73-115
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000000279
Family H-NS histone-like proteins 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R0CVF2
Sequence length 138
Comment (tr|A0A0R0CVF2|A0A0R0CVF2_9GAMM) DNA-binding protein {ECO:0000313|EMBL:KRG69267.1} KW=Complete proteome OX=405446 OS=Stenotrophomonas terrae. GN=ABB27_06695 OC=Xanthomonadaceae; Stenotrophomonas.
Sequence
MSIDLNTLDLRELNTLIRAAQDRHKALTQRQPAEKVRRKLTALAKQTGYTIEELFGPAAD
TAALKSKPARRKGPKIKPKYRDPENRWNTWTGRGKMPLWLASKIRFGQTPTDFLIPGVAK
LTPKEKVLTGKRKLFKQS
Download sequence
Identical sequences A0A0R0CVF2
WP_057627604.1.1687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]