SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R0DCX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R0DCX7
Domain Number 1 Region: 4-203
Classification Level Classification E-value
Superfamily YcfC-like 4.32e-60
Family YcfC-like 0.0000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R0DCX7
Sequence length 204
Comment (tr|A0A0R0DCX7|A0A0R0DCX7_9GAMM) High frequency lysogenization protein HflD homolog {ECO:0000256|HAMAP-Rule:MF_00695, ECO:0000256|SAAS:SAAS00958394} KW=Complete proteome; Reference proteome OX=517011 OS=Stenotrophomonas chelatiphaga. GN=ABB28_03415 OC=Xanthomonadaceae; Stenotrophomonas.
Sequence
MSFTVDDRVLALAGIAQALQQVRRIADTGHSDAGAVRTAMDSVFRIDAASPQDVYGDRES
LKPGLRLLHNYFRNQGQDPILPKLALAVLQLERRFVREPDTIAKVTAGIERASRQGRELG
DSGHPDVLATLGGVYADTISHLKPRVMVQGNPHYLGQAGVVAEIRALLLAAVRSAVLWRQ
LGGSYWDFLLARKAMVEAVDRALR
Download sequence
Identical sequences A0A0R0DCX7
WP_057507267.1.47249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]