SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0R0JQ25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R0JQ25
Domain Number 1 Region: 16-162
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-28
Family Capz beta-1 subunit 0.000063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R0JQ25
Sequence length 163
Comment (tr|A0A0R0JQ25|A0A0R0JQ25_SOYBN) Uncharacterized protein {ECO:0000313|EMBL:KRH54834.1, ECO:0000313|EnsemblPlants:KRH54834} KW=Complete proteome; Reference proteome OX=3847 OS=Glycine max (Soybean) (Glycine hispida). GN=GLYMA_06G212500 OC=Phaseoleae; Glycine; Soja.
Sequence
MMLARSLPQHTSSLRTSLSLSATLTHHTYLSLKYYEGGISSVYMWEDDNEGFVACFLIKK
DGSKTGQGRRGYLEEGAWDAIHVIEVGPEEEENTNYQLTSTVMLTLTTNNESSGTFSLSR
SIRHQISMKLSVADGHLCNMGRMIEEMESKLRNSLDQVIVSKE
Download sequence
Identical sequences A0A0R0JQ25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]