SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R1JXT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R1JXT6
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily PTS IIb component 2.75e-44
Family PTS IIb component 0.0000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R1JXT6
Sequence length 167
Comment (tr|A0A0R1JXT6|A0A0R1JXT6_9LACO) Mannose pts, eiib {ECO:0000313|EMBL:KRK76045.1} KW=Complete proteome; Reference proteome OX=1423773 OS=Lactobacillus namurensis DSM 19117. GN=FD30_GL001675 OC=Lactobacillus.
Sequence
MAIQLARVDDRLLHGQVATVWTKAIRPNRILVVSDNVAQDHLRKLLIMQAAPPEVKANVI
TVAKMVQIYRDARFDQFRPLVLTETLGEMAELAAQGIDLTETGVNVGNLAYTVHKTMLTP
SVAADTADVTAVQQLVAAGVNVYTQTVPTDRQQAFLTLATKQGLTAN
Download sequence
Identical sequences A0A0R1JXT6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]