SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R1MNX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R1MNX6
Domain Number 1 Region: 1-160
Classification Level Classification E-value
Superfamily PTS IIb component 7.32e-47
Family PTS IIb component 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R1MNX6
Sequence length 163
Comment (tr|A0A0R1MNX6|A0A0R1MNX6_9LACO) PTS system, IIB component {ECO:0000313|EMBL:KRL06778.1} KW=Complete proteome OX=1423759 OS=Lactobacillus hordei DSM 19519. GN=FC92_GL000374 OC=Lactobacillus.
Sequence
MDIRLLRIDSRLLHGQVTTNWAKVTKVNRILVVSDKVAKDKIRRTLLIQASPPGIRVNVI
TVAKMIGIYHDIRFGLLKVMILVEEPEDARRLIAGGIAVDTVNIGAISFDRTKVMVSDAI
AVNDADVAAFSWIHKKGIKLDVRKVSGDGSKDLWHALSEKKLV
Download sequence
Identical sequences A0A0R1MNX6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]