SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R2L285 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R2L285
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily PTS IIb component 1.7e-30
Family PTS IIb component 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R2L285
Sequence length 144
Comment (tr|A0A0R2L285|A0A0R2L285_9LACO) Phosphotransferase enzyme IIB component {ECO:0000313|EMBL:KRN95903.1} KW=Complete proteome; Reference proteome OX=449659 OS=Lactobacillus pobuzihii. GN=IV66_GL000927 OC=Lactobacillus.
Sequence
MVWSRALDLDGIVVANDETAGDDMQKMALKMAVPSGLKVIIKSLQGAIDLLSDPRAEKMK
LFVLVRTVGDAVKLAEKLPDIKYVNIGNVGKAVEGQKHTFTQFVMLTDEEIESLRQLVKL
YPETALQNLPDNKKLLATDELKKL
Download sequence
Identical sequences A0A0R2L285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]