SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R2MS18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R2MS18
Domain Number 1 Region: 6-162
Classification Level Classification E-value
Superfamily PTS IIb component 9.02e-52
Family PTS IIb component 0.0000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R2MS18
Sequence length 163
Comment (tr|A0A0R2MS18|A0A0R2MS18_9LACO) N-acetylgalactosamine-specific PTS system transporter subunit IIB {ECO:0000313|EMBL:KRO16375.1} KW=Complete proteome; Reference proteome OX=1293598 OS=Lactobacillus saniviri JCM 17471 = DSM 24301. GN=IV56_GL001157 OC=Lactobacillus.
Sequence
MMTEPNILVTRIDNRLVHGQVGMTWVNTIGANLIVVANDDVSKDSVQQNLMEMVIPDTVG
IRFFSIEKTIRVIGKAAPTQKILLVIRTPQDALALIKGGVPIKKLNIGNLHFAEGKKQLS
ATVSVSQDDIDTFNELHNMGIQLEVQGIPNERATDLMDLLAKA
Download sequence
Identical sequences A0A0R2MS18

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]