SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R2QPP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R2QPP9
Domain Number 1 Region: 20-223
Classification Level Classification E-value
Superfamily YojJ-like 2.88e-58
Family YojJ-like 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R2QPP9
Sequence length 242
Comment (tr|A0A0R2QPP9|A0A0R2QPP9_9FLAO) Diadenylate cyclase {ECO:0000256|SAAS:SAAS00772190} KW=Complete proteome; Reference proteome OX=1655587 OS=Cryomorphaceae bacterium BACL11 MAG-121001-bin54. GN=ABR79_01655 OC=Cryomorphaceae; unclassified Cryomorphaceae.
Sequence
VAILIYQIYKLIKGTVAMNIFIGLAVIYILWKIVSAFHLQLLGEILGQFIGFGVILLAIV
FQQELRKFLMMIGKGKVMKNKGLFKFNFTKANDNQLNTLAITKACENMAKTKTGAIMIVT
QIDDLAVFCESGIEMNAVISAPMIESIFYKNSPLHDGAVIIRNNKIISARSVLPVSNSSE
LPRRLGMRHRAAVGITEESDAIAIIVSEETGEISYVKDGELFTKKTAQQLEQFLNSIFTQ
TQ
Download sequence
Identical sequences A0A0R2QPP9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]