SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0R3NIE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3NIE0
Domain Number 1 Region: 242-452
Classification Level Classification E-value
Superfamily MIR domain 1.92e-57
Family MIR domain 0.000000219
Further Details:      
 
Domain Number 2 Region: 453-623
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 8.11e-53
Family IP3 receptor type 1 binding core, domain 2 0.000000602
Further Details:      
 
Domain Number 3 Region: 1226-1381
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.88e-37
Family IP3 receptor type 1 binding core, domain 2 0.0081
Further Details:      
 
Domain Number 4 Region: 112-217
Classification Level Classification E-value
Superfamily MIR domain 0.000000000000549
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R3NIE0
Sequence length 2855
Comment (tr|A0A0R3NIE0|A0A0R3NIE0_DROPS) Uncharacterized protein, isoform B {ECO:0000313|EMBL:KRT00770.1} KW=Complete proteome; Reference proteome OX=46245 OS=Drosophila pseudoobscura pseudoobscura (Fruit fly). GN=Dpse_GA10452 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGDNIIGSASFLHLGDIVSLYAEGSVCGFLSTLGLVDDRTVVCPEAGDLSCPPKKFRDCL
IKICPMNRYSAQKQFWKAAKQSASSNTDPNLLKRLHHAAEIEKKQNETENKKLLGTSIQY
GRAVVQLLHLKSNKYLTVNKRLPSLLEKNAMRVYLDANGNEGSWFYIKPFYKLRSIGDYV
VVGDKVILSPVNADQQNLHVAASYELPDNPGCKEVNVLNSSTSWKISLFMEHKENQEHIL
KGGDVVRLFHAEQEKFLTMDEYKKQYHVFLRTTGRTSATAATSSKALWEIEVVQHDSCRG
GAGDWNSLYRFKHLATGHYLAAEAEVDVAAGISASAVAAHELLLGDCSKDSGLSSTMNST
LNEKPKGKQYRLVSVPYSADIASVFVLDATTMARPDSLVPQSSYVRLQHICSNTWVHATS
IPIDADDDKPVMSKVCCSPIKEDKEAFALIPVSPVEVRDLDFANDACKVLALVTSKLDNG
SISINERRALISLLQDIVYFIAGMENEQNKTKALEFTIKNPIRDRQKLLREQYILKQLFK
ILQGPFQEHTAGDGPFLRLDELGDPKNAPYKNIFRLCYRILRLSQQDYRKNQEYIAKHFG
LMQKQIGYDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKNMHNWDSRFLDYLSD
LCVSNRKAIAVTQELICKSVLSDKNKDILIETQVKALKSSATLVRCYKGTTEDVCLATLT
EVAGDDEDRSDVQSTSTTTTWDSASLNEDEELMSPGDKYEIHLKWTGQPTSRSMADLADS
VADGSEQDAAILNYYRHQLNLFSNMCLNRQYLALNELSPRLDIDLILKCMSDETMPYELR
ASFCRLMLHLHVDRDPQEPVTPVKYARLWSEIHTKMSIMDYDGKNQQPDQNKQACRAKFN
TTIAFVENYLCNVATKVWLFTDQEQNKLTFEVVKLARDLIYFGFYSFSDLLRLTKTLLSI
LDCVSDTSTGGAFASTDIDSEGGVLRSIGDINTVMTSLALGSVGQAIAAPSMALQQRKSV
SQLMKEYPLVMDTKLKIIEILQFILDVRLDYRISCLLSIFKREFDESDVAAAATNGGESG
TPQPQSQSQAQPSPLSTPNDPSDPMANAEAMAAAAAAAAATAARQKNIDLESIGVQAEGI
FDCERSDAANLDLDGQGGRTFLRVLLHLIMHDYAPLVSGALHLLFRHFSQRQEVLQAFRQ
VQLLVSDSDVESYKQIKSDLDILRQSVEKSELWVYKAKATDELGGTDPAGDAVNVEYNAA
LSQEQRNEYRKVKEILMRMNKFCVTASGYGHGSSVVKPRKHEQRLLRNVGVHTVVLDLLQ
NPYDEKDDELMKELMCLAHEFLQNFCLGNQQNQVLLHNHLDLFLNPGILEAKTVCAIFKD
NLALCNEVTDKVVQHFVHCIEIHGRHVAYLQFLQTIVKAENQFIRKCQDMVMQELINSGE
DVLVFYNDKTSFQHFVQMMQQQQLARMEKLSDDSPLKYHVELVKLLACCTMGKNVYTEIK
CNNLISLDDIVTVICHPLCMPEVKEAYVDFLNHCYIDTEVEMKEIYASGHMWNLFEKSFL
VDIHQLISNAAASANKTLQAYVLNGVTNLLGSFFSSPFSDQSAIVQTRQLIFVQLLQSAY
RLTQCKWMSLADRFNVENCIRTLVESAKMRSIALPLELEQQVANMSSKTAMLTRQTTKWL
LASKQPKYETQQSATLMRWDRSIIEGLQDIVSLLEDQLKPVVEAELSLLVDILYRSELLF
PAGTESRKRCESGGFIRKLIKHTEKLLEEKEERMCVKVLRTLREMMAIDVNYGEKGDALR
QTLLLRYFQCKSTPRLEEDLLSPLRAAVPPMSEMAKQHHLVTHGPGAKYLARAGKTLHEM
QNHLDREGASDLVVELVIKSVHSPNIFVEAVELGIALLEGGNPIIQKGIFQKFLSDDLNQ
AFFKVFFEKMKDAQQEIKSTVTVNTTDIAAKAHEHKADTNLELDKISRKHGLKSNGVVIT
EELKRELHNAGLATVRAYGNARNIHSGEESSSISVNSPLEDILAEKLEKHKDSKEQRNQL
SNKVLVMQPILRFLQLLCENHNPDMQNLLRNQNNKTNNNLVSETLMFLDCICGSTTGGLG
LLGLYINEHNVALINQTLETLTEYCQGPCHENQNCIATHESNGLDIITALILNNINPLGE
NRMDLVLELKNNASKLLLAIMESRGDSENAERILYNMNPKQLVEVACKAYHQEELIDEHD
EADEPDAATDDDDATVSPREVGHNIYILCHQLAQHNKELAGLLKASEDPQSASFDAKTSQ
ALMYYATHTAQIEIVRNDRTLEQIVFPIPEICEYLTTDTKIKILNTAERDDQGSKVADFF
DKAEEMFNEMKWQKKLRSQPLLFWISSYMSLWSNILFNCVVVINIIVALFYPFDKSNTVP
DLSPHISLLFWIIMLLSLVFVIMLPRASGIRTLIGSAILRSNFLLGPESTLCLLGVVTVT
LKSVHIVSIMGNKGTLEKKLIKIITDMQLLYHCIYIAFCFCGLIVHPFFYSLLLFDVVYR
EETLVNVIRSVTRNGRSIVLTAVLALILVYLFSIIGYMFFRDDFLVSVDFDEQENTGSPL
GMAMPPVTVSVPPAVEEFCTAPDALGNCGGSKTLPASSDVASNGGSAGGDVKERSCDSLV
MCIVTTLNQGLRNGGGIGDILRAPSSKEGLFVARVIYDLLFFFIVIIIVLNLIFGVIIDT
FADLRSEKQQKEAILKTTCFVCSLNRSAFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKD
PTEFTGPESYVYAMVKAGILEWFPRLRAMSLAAVDADGEQIELRSMQTQLLETQLLIKNL
STQLHELKDHMTEQRKQKQRLGLLNTTANSLLPFQ
Download sequence
Identical sequences A0A0R3NIE0
XP_015037801.1.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]