SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0R3QMQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3QMQ1
Domain Number 1 Region: 281-482
Classification Level Classification E-value
Superfamily MIR domain 3.58e-48
Family MIR domain 0.0000185
Further Details:      
 
Domain Number 2 Region: 484-654
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.23e-45
Family IP3 receptor type 1 binding core, domain 2 0.00000901
Further Details:      
 
Domain Number 3 Region: 1189-1337
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.05e-27
Family IP3 receptor type 1 binding core, domain 2 0.0075
Further Details:      
 
Domain Number 4 Region: 142-215
Classification Level Classification E-value
Superfamily MIR domain 0.000000000405
Family MIR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R3QMQ1
Sequence length 1473
Comment (tr|A0A0R3QMQ1|A0A0R3QMQ1_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:BTMF_0000898601-mRNA-1} KW=Complete proteome; Reference proteome OX=42155 OS=Brugia timori. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MLRNQHCLYNNKLSIAMSLDTFHNTSLHIGDVISLYAEDYSRPVEDRLEERLFPRTGFLS
TLGLVDDRCIVEIGNGTPDSPPKKFRDCLFRVCPINRYAAQKQFWTEQKKFQVGESLFEE
DMLKKLKHAADKEKEQNDMEYKKMLGANVQYGGTIQLLHVKSDKYLTVLKNSPAKLERNA
MKVYLDKNGHEGSWFYVEPVYKHSFFGDNVNGGDRISLVPYSYCPIPNTTGHVKPQLHLS
HLSLPDHPIGFEVNCSNELTEWQVLMFLQFDENQENIVKSGDVVRLFHAEQQTFLTLDTV
PKTNKDAVFLRLTNRPSAADATSSRALWEIQVVQFDSYRGAAASWLREFRFKHLATDMYL
SVERMRLNKTENTPTNTVSSLPEAEYCDDGQYYLVPKHSEKPETDESLLFVLDPCTFTKM
DARISQRTYVRLWHVCTNTWIHTTDPTEKQNLYHFSSNEKGWVKVVSENFKIDKETFALL
PVRPDEVRDLDFANDACKALNGFVKLIRSGMIISKEPMNVTIQLLTECIFFVTNQSNHVT
DPIKIVDFKPPRDRQKLLREQGVLDQVFALLRAPFLPRNGIDPEPLLCSPRKLSEKGNEI
FKQIFHLCYSLLRYSQVGYRKNQEYLAEKFGQIQEQIGFDLLAEDTMTAVLHNNPKLLEK
YVKNPHVERFVELVRNNKDGRFLVYLADLCVCRGEANKKIQELICNCVLNEVNRDIFIRT
IIYDKSSNEVWICWSNSYCKQLVSVAMDAAKGQTEDIEVLDYYKHQLDLLAQMCHDQQYL
AIDPPPERRLLNLSLELPADLVLRCISDTRLPQDLRASFARLMLHLHVIRGSPLNAVHHA
RLWREIPLNSTVSGNSSRCVNGYVDSGYVRSGGEVFDKVLKTVDVYLEELRKTTREGEPV
LDPSLSKLKQNRLTFEIVTLARALAHFEFYSFADLLRLAQNLLAIADSSPKKPEDKMAFD
KTGLFRHVTYSVIGANALQKGAKQYLQHMKTESACNENTLQVKESKQMVLQTKLIIVEIL
NFIMDIRRDYRITVALSWFKKHFPYLSEHEASELYKEVFQNCEENLDFDGRNGQLLLRIL
LQMTISDFSKLTSTALTVQLLVSNDDVENYQQIDRDLFILKILTEKSELWVQADKTRPES
SSKLSFEEHGSSLDDSSKLLLSIRATSQQLEDSGLNATCAFHNNESFLSLVEKIEQHYYF
ARDECIKLLCKLLLGDDRTEAASALYELFDRAPLVCYPLVKQILYRVKQLCYKNDKPNKM
NQQLLRNMRVHEYVLGFLSVPYDEKNDAEMPKLVTLSHEFLRSFCRNNIENQFRLYKHVS
IEQDAKEGCLRVDTMEEVATLTAIFKNXXEEVATLTAIFKNNRILCQNVSEEVIAHIVNM
IEHKARSSVYIEFLQTVVMVQAKEIKSAQEKVAQEICSSSDDVRVYYADSASFEQLKQLM
HNTGPEDLTADHPLRYHIDLVRYVYNFIQLTLK
Download sequence
Identical sequences A0A0R3QMQ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]