SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3SBH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3SBH0
Domain Number 1 Region: 62-154
Classification Level Classification E-value
Superfamily WWE domain 1.96e-27
Family WWE domain 0.0000812
Further Details:      
 
Domain Number 2 Region: 6-55
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000746
Family RING finger domain, C3HC4 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0R3SBH0
Sequence length 223
Comment (tr|A0A0R3SBH0|A0A0R3SBH0_HYMDI) Uncharacterized protein {ECO:0000313|WBParaSite:HDID_0000181901-mRNA-1} KW=Complete proteome; Reference proteome OX=6216 OS=Hymenolepis diminuta (Rat tapeworm). GN= OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MESGSSDCPICLQPLLQPVEIPCGHIFCYLCLKGSAFHRRKCPLCRGGITMGFFNNPNMI
HSTIEGPKQDRIPSELVWYYEGRNGWWQYDERTANEIESAFSQSLSKCEVFIAGHFYIID
FVNMCQFRKDHSGRSRRIKRDSPNTSKKGVAGIRLSLLQPSSEANVNEDSGEDPTNDNIS
DTSDFLSVSSSVNFTSHRLVPTGNSSSPNSAPSPRPNTPPAPS
Download sequence
Identical sequences A0A0R3SBH0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]