SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3TFQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3TFQ7
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily BEACH domain 8.11e-32
Family BEACH domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R3TFQ7
Sequence length 258
Comment (tr|A0A0R3TFQ7|A0A0R3TFQ7_HYMNN) Uncharacterized protein {ECO:0000313|WBParaSite:HNAJ_0000589801-mRNA-1} KW=Complete proteome; Reference proteome OX=102285 OS=Hymenolepis nana (Dwarf tapeworm) (Rodentolepis nana). GN= OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
LDVLKRYVRSVYRPQEFPSSLQRLYATTPEECIPEFFTDCSIFSSIHPDMPDLQLPDWFQ
GTPSDFLTYHRRVLECDAVSSNLHYWIDLTFGYKLIGEAAATAKNVHLELVSPNPPSNSR
VTCLFSLPHPRRVTASTPPEDLISIYEEMYDFFSKICSDLEDLACLITEVSVGITIPASF
PLIDNVNSQSRLKRARQFFKTYNSSIPTGFRKPVELILFSRNHDLPLSLIRRCVFRVPSF
ISDLHRIQIGLDSRSAIS
Download sequence
Identical sequences A0A0R3TFQ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]