SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3TL31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3TL31
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-47
Family Calponin-homology domain, CH-domain 0.0000019
Further Details:      
 
Domain Number 2 Region: 230-276
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000366
Family EB1 dimerisation domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R3TL31
Sequence length 286
Comment (tr|A0A0R3TL31|A0A0R3TL31_HYMNN) Uncharacterized protein {ECO:0000313|WBParaSite:HNAJ_0000792101-mRNA-1} KW=Complete proteome; Reference proteome OX=102285 OS=Hymenolepis nana (Dwarf tapeworm) (Rodentolepis nana). GN= OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MSIQATNVYSTNQTADNLSRHDILNWINTCLESNYGKIEELCTGAAYCQLMDMLFPGTLN
FKKIKFNTHLEHEYISNFKQLQAIFKKLGVDKEVPIEKLVKGKYQDNFEFVQWFKRFYDA
NYTGQPYDALSARGGEQIGGSGKPSAKPRAAPARPALTTTVRTTAPHPGRISSFYHDPST
LINIVNVAPLFIKHLRSPSAKLVVIPHLQDLALITKPPPNLIVLHRLLTHFFYLCFQRDF
YFNKLREIEDLCGKVDENEMTKKLLDILYATEEGFVPPEPEEPEEF
Download sequence
Identical sequences A0A0R3TL31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]