SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0R3TMH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3TMH0
Domain Number 1 Region: 13-243
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.94e-26
Family Capz beta-1 subunit 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0R3TMH0
Sequence length 271
Comment (tr|A0A0R3TMH0|A0A0R3TMH0_HYMNN) Uncharacterized protein {ECO:0000313|WBParaSite:HNAJ_0000851301-mRNA-1} KW=Complete proteome; Reference proteome OX=102285 OS=Hymenolepis nana (Dwarf tapeworm) (Rodentolepis nana). GN= OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MGEVLMRDEIQDLKLLSSIPPNRISDVIVSLKKHFPFIFAFDSPERLFPLDVSQDSTGRK
YICCDANRYMGSTRSPWNNAFLPHISDAPLPKEQHRYLEERLNYALVHYASSYYNHQPIT
SVYCLSRDVGVIVCCLIKSPHIEIAYLIDVNEKFISSINYSLSVVYSIKLTEQEFVDKDM
GNLCFSLYFRHRRSKEIKVSSTNLTESHIRNIGRLIEKVDSDVFGKLRAVYPIQTRLILQ
ELRTDKSTLPPKQTIAFKEELAAALTSRGDS
Download sequence
Identical sequences A0A0R3TMH0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]