SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3WRY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3WRY3
Domain Number 1 Region: 197-285
Classification Level Classification E-value
Superfamily BEACH domain 1.57e-17
Family BEACH domain 0.0036
Further Details:      
 
Domain Number 2 Region: 109-192
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000081
Family Protein kinases, catalytic subunit 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0R3WRY3
Sequence length 330
Comment (tr|A0A0R3WRY3|A0A0R3WRY3_HYDTA) Uncharacterized protein {ECO:0000313|WBParaSite:TTAC_0000352301-mRNA-1} KW=Complete proteome; Reference proteome OX=6205 OS=Hydatigena taeniaeformis (Feline tapeworm) (Taenia taeniaeformis). GN= OC=Cyclophyllidea; Taeniidae; Hydatigera.
Sequence
MTEENVNNIRWDLDVRNLDASLRNSKWQDKMIECTFSDALSILREIELNTDKDFLTSKYA
CEIITHGTTAPEYSYVKVKDLVQKAISTYSDLLDDSLVATEDSKLTARIKGHSLFSLIRY
NPSRLKDENLLQFVFYQLICLLECFHRRGIPYLNLEPISIFVDDLFRVSLAPPCVCKLGE
FACFETNQSNPLKETLPIQNSVEFHEVLSGWITGKVSNYDYLMYINHLAGRRAGDPTASA
VLPWVTDFSSPQDGAQHLRDLTRTKFRLTKGERQLDATYLHLEHSDSSSLAGESGKVEPF
LPHHILDMMPNLAYYTYKVQCCWRHVSPDI
Download sequence
Identical sequences A0A0R3WRY3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]