SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3X3F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3X3F9
Domain Number 1 Region: 1-246
Classification Level Classification E-value
Superfamily BEACH domain 1.31e-93
Family BEACH domain 0.000000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R3X3F9
Sequence length 266
Comment (tr|A0A0R3X3F9|A0A0R3X3F9_HYDTA) Uncharacterized protein {ECO:0000313|WBParaSite:TTAC_0000788101-mRNA-1} KW=Complete proteome; Reference proteome OX=6205 OS=Hydatigena taeniaeformis (Feline tapeworm) (Taenia taeniaeformis). GN= OC=Cyclophyllidea; Taeniidae; Hydatigera.
Sequence
LPWILADYTSKQLNFDEPATFRDLSRPIGIVNPDNIATVREKYESFEDPSGAISKFHYGT
HYSSAAGVMHYLVRTEPFTSLHIHLQGQRFDVADRQFNSIPMAWSLIMSSPYDNRELIPE
FFHFPDFLRNDNDFDLGRLQVSGKKVDDVELPPWASTPEEFIRIHRGALESDYVSANLHK
WIDLIFGYKQRGKAAENALNVYYYLTYEGAVDLDDVTDPIEHASIEGMIKNFGQTPCQLL
KVSSPQMNKIFPEEHQEFALAVAHHE
Download sequence
Identical sequences A0A0R3X3F9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]