SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0R4IEP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R4IEP3
Domain Number 1 Region: 8-279
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-113
Family Capz alpha-1 subunit 0.000000000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0R4IEP3
Sequence length 315
Comment (tr|A0A0R4IEP3|A0A0R4IEP3_DANRE) Capping protein (actin filament) muscle Z-line, alpha 1b {ECO:0000313|Ensembl:ENSDARP00000133155} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=capza1b OC=Cyprinidae; Danio.
Sequence
MTDFEEPLSDEEKVRIAANFVTHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKLDGSEESVLITEHGDLGQGRFFDPRKRVSFRFDHLRKEASDPQPYEGESALRSW
RDACDDALSAYVKEHYPSGVCTVYGKTVDGQQTIIACIEGHKFEPKNFWNGRCRSEWKFN
ISQSSAQVVGVLKIQVHYYEDGNVQLVSHKEVEESIVVTNEVQTAKEFAKIIENAENDYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIAASCFNSFSFMLVQWAITSFN
TPSGFRHTGLCLPSS
Download sequence
Identical sequences A0A0R4IEP3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]