SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0R4IX04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R4IX04
Domain Number 1 Region: 236-445
Classification Level Classification E-value
Superfamily MIR domain 4.1e-66
Family MIR domain 0.0000000103
Further Details:      
 
Domain Number 2 Region: 448-612
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.35e-59
Family IP3 receptor type 1 binding core, domain 2 0.0000000554
Further Details:      
 
Domain Number 3 Region: 1133-1290
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.1e-33
Family IP3 receptor type 1 binding core, domain 2 0.0068
Further Details:      
 
Domain Number 4 Region: 107-219
Classification Level Classification E-value
Superfamily MIR domain 1.18e-19
Family MIR domain 0.015
Further Details:      
 
Domain Number 5 Region: 1242-1350,1428-1514,1543-1562,1608-1696,1975-2085
Classification Level Classification E-value
Superfamily ARM repeat 0.0000156
Family Diap1 N-terninal region-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R4IX04
Sequence length 2779
Comment (tr|A0A0R4IX04|A0A0R4IX04_DANRE) Inositol 1,4,5-trisphosphate receptor, type 1b {ECO:0000313|Ensembl:ENSDARP00000139056} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=itpr1b OC=Cyprinidae; Danio.
Sequence
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPESGDLNNPPKKFRDCQFRL
CPMNRYSAQKQFWKAAKPGGNSTTDTVLLNKLHHAADLEKKQNESENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDSAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKEAILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEIEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVNPDYEEESQESRSSVADFSPFNFQLDSEHEALRARLRTPNEK
VMYSLVSVPDGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNNPIDKEE
EKPVMLRIGTSAVKEDKEAFAIVPVPPAEVRDLDFANDASKVLASIAGKLEKGTITQNER
RFVTKLLEDLVFFVVDIPNNGQDVLEIMVNKPNRERQKLMREQNILKQIFKLLQAPFTDS
GDGPMLRLEELNDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFRFMQKQIGYDVL
AEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQE
LICNAVLNPANADILIETKLVLSRFEVESGEGPMESEIDEEEVWLFWKNSNKEVKSKSIR
ELAQDAKEGQKDDQDVISYYRYQLNLFARMCLDRQYLAIEKISGQLDVDLILRCMSDEDL
PYDLRASFCRLMLHMHVDRDPQEQVMPVKYARLWSEIPSKIAIDDYDNDGTSRDEIKERF
ALTMDFVENYLRDVVLQNVPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLA
ILDCVHVSTIYPINKMEKGDESKSSNVMKSIHGVGELMTQVVLRGGGFLPTTPTTPPDGD
VVKTQTEPEKEDILVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNTQTDTAP
APNADGPNSIPNIPALDFENIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDY
PPLVSGALHLLFRHFSQRQEVLMAFKQVQLLVTSQDVDNYKQIKSDLDQLRSNVEKSELW
VYKRQGDEGMDGGDGLPAESDHKKKRDSGSDKKKTDGNGSDNYRDVKEILLRLSKLCVQE
GPSGKKSKKQQQRLLRNMGAHSVVLELLQIPYEKGEDVRMQEIMKLAHEFLQNFCAGNQQ
NQALLHKHINLFLNPGILEAITMQHIFMNNFQLCSEMNERVVQHFVHCIETHGRHVQYLK
FLQTIVKAENKFIKKCQDIVMAELVNSGEDVLVFYNDRASFQTLVQMMRSERDRMDENSP
LMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHKDCIPEVKIAYINFLNHCY
VDTEVEMKEIYTSNHMWKLFENFLVDICRVCNNTSDRKHADTTLESYVTETVMSIVTTFF
SSPFSDQSTSLQTRQPVFVQLLQGVFRVYHCSWLLPSQKGSVESCIKVLSDVAKSRAIAI
PVDLDSQVNNLFVKSNNVVQKTILNWRLSARNASRRDSTLTASKDYRNIIERLQDIVSAL
EDRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFISKLIKHTKQLLEENEERL
CIKVLQTLREMMTKDRGYGEKLIAFDDELDVAELAPPPEPEVPAEEFDPNQPQKQLEDQK
RSEALRQVLVNRYYGNFKPGGRRDSLTNFSNGPLTPVGQTKTPAGGGGGGGGGSAGSRGE
LSLAEVQCHLDREGASDLVIDLIMNATSDRIFQESILLAIALLEGGNPVIQRSFFCRLTG
DNKSEKFFKVFYERMKLAQQEIKATVTVNTSDLGSKRKDEDTNDKDVQSRKKVKDVAVIT
EEVREQLLEASTVTKKAFSTYRREADADEHLNATEGPSSTAEKNQDENEMSVIITIMQPI
LRLMQLLCENHNRELQNFLRCQNNKNNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKN
VALINQTVESLTEYCQGPCHENQNCIATHECNGIDIIIALILNDINPLGKKRMDLVLELK
NNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEIEVEHTDDGENGEEEH
AASPRNVGHNIYILAHQLARHNKELQAMLKPGGTYGEGDEALEFYAKHTAQIEIVRLDRT
MEQIVFPVPNICEFLTQESKLRVYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRGTQ
EATGNANSVPSQPILYWCSRNMSFWSSISFNLAVLMNLLVAFFYPLEGGGVRGGTLEPHL
SALLWAAMLVSLAIVIVLPQPHGIRALIASTILRLIFSVGLEPTLFLLGAFNVGNKVIFL
MSFVGNRGTFTRGYKAMIMDVEFLYHLLYLIICSLGVFVHVFFYSLLLFDLIYREETLLN
VIKSVTRNGRSIVLTAVLALILVYLFSIVGYIIFKDDFILTVDRISNKTLEQSASKMGEF
LAGAVCRKEENCSTETMMDAVGVQSSALVIEDKERTCDSLLMCIVTVLSHGLRSGGGVGD
VLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTC
FICGLERDKFDNKTVTFEEHIKVEHNMWHYLFFIVLVKVKDSTEFTGPESYVAEMIRDHN
LDWFPRMRAMSLVSSDAEGEQNEIRSLQEKLESTMKLISNLSSQLTELKEQMTEQRKQKQ
RIGLLGHPQHMNVNPQQPA
Download sequence
Identical sequences A0A0R4IX04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]