SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S0ZIH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S0ZIH4
Domain Number 1 Region: 19-186,238-257
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 4.06e-84
Family Cytochrome f, large domain 0.0000000443
Further Details:      
 
Domain Number 2 Region: 186-237
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.00000000000000597
Family Cytochrome f, small domain 0.00019
Further Details:      
 
Domain Number 3 Region: 253-289
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.0000000000000929
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S0ZIH4
Sequence length 289
Comment (tr|A0A0S0ZIH4|A0A0S0ZIH4_9ASTE) PetA {ECO:0000313|EMBL:ALI90226.1} OX=23278 OS=Vahlia capensis. GN=petA OC=Pentapetalae; asterids; lamiids; Vahliales; Vahliaceae; Vahlia.
Sequence
ISVSLMIYIITRTSISSAYPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPD
TVFEAVVRIPYDMQLKQVLANGKKGGLNVGAVLILPEGFELAPPDRISPEMKEKIGNLSF
QSYRPNKKNILVIGPXXXXXXXXXXXXXXXPGQKYSKYVHFLKYPIYVGGNRGRGQIYPD
GNKSNNTVYNATAAGIVSKIIRKESDGRQVVDIIPPGPELLVSEGESIKFDQPLTSNPNV
GGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAE
Download sequence
Identical sequences A0A0S0ZIH4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]