SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S2IQ12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0S2IQ12
Domain Number - Region: 6-37
Classification Level Classification E-value
Superfamily Coronavirus NSP7-like 0.0144
Family Coronavirus NSP7-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S2IQ12
Sequence length 58
Comment (tr|A0A0S2IQ12|A0A0S2IQ12_LEPBO) Uncharacterized protein {ECO:0000313|EMBL:ALO25720.1} KW=Complete proteome OX=280505 OS=Leptospira borgpetersenii serovar Ballum. GN=LBBP_01429 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MVFCTIALHNKVNKIESPGKHFEKKVSFLGSLFTFESLSTGSLSESLSCNNERYQELN
Download sequence
Identical sequences A0A0S2IQ12 M3FB81 M6E3W9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]