SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S3TIF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0S3TIF0
Domain Number - Region: 62-93
Classification Level Classification E-value
Superfamily BEACH domain 0.00366
Family BEACH domain 0.014
Further Details:      
 
Domain Number - Region: 18-60
Classification Level Classification E-value
Superfamily HMG-box 0.00495
Family HMG-box 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S3TIF0
Sequence length 107
Comment (tr|A0A0S3TIF0|A0A0S3TIF0_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:BAU04840.1} KW=Complete proteome OX=1752063 OS=Fischerella sp. NIES-3754. GN=FIS3754_07290 OC=Bacteria; Cyanobacteria; Nostocales; Hapalosiphonaceae; Fischerella.
Sequence
MGFFDSEIVQQEAKQLFEDYQALIKLGSNYGKFDREGKKLFIEQMEAMMERYRVFMKRFE
LSEDFMAQMTIQQLKTQLSQFGVTPQQMFDQMHITLERMKAELEKQN
Download sequence
Identical sequences A0A0S3TIF0 A0A1U7H3I6 G6FVA4
WP_009457540.1.31758 WP_009457540.1.58140 WP_009457540.1.66985 WP_009457540.1.88741 WP_009457540.1.99962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]