SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0S4JGK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S4JGK1
Domain Number 1 Region: 125-191,221-355
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.75e-33
Family Capz alpha-1 subunit 0.00036
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00000000275
Family Capz alpha-1 subunit 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S4JGK1
Sequence length 367
Comment (tr|A0A0S4JGK1|A0A0S4JGK1_BODSA) F-actin capping protein, putative {ECO:0000313|EMBL:CUG89243.1} KW=Complete proteome; Reference proteome OX=75058 OS=Bodo saltans (Flagellated protozoan). GN=BSAL_20055 OC=Eukaryota; Euglenozoa; Kinetoplastida; Bodonidae; Bodo.
Sequence
MALHDVESIRGFVLQAPPGQLQEVLKSLHSLCGGSPTFFESIHDACLEYTMRHLCAFVLS
GDAQQDRGTVVMCSKHNQLIARIKRRCKHLGVEGETILAEFLEYFSTFSGPSPTEGDDLA
PFANIDSVFFDFNARVYFEVDPVEGRVVRCKPFATGQAASGEVAALQSPDNALHQLIASG
VDNYVRSAFGAEVWWQHGRQKMFGGQNATEDRSQKKLRSSRNVAGSHVSVDADSFLVAIS
CERYTPSSRWAARWKSLYQVTVMGGVATVRGEGRVDGHYFEDSNIHVSVEDVMPETTVTV
ASSAETADAIVETIRNAETDLQKKLEHNSKAISETALRGLRRRLPVTKQPFDFQKAMLQL
PSVEERF
Download sequence
Identical sequences A0A0S4JGK1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]