SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7DY59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7DY59
Domain Number 1 Region: 23-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.37e-37
Family PDI-like 0.011
Further Details:      
 
Domain Number 2 Region: 143-255
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.79e-33
Family PDI-like 0.008
Further Details:      
 
Domain Number 3 Region: 267-360
Classification Level Classification E-value
Superfamily ERP29 C domain-like 3.01e-23
Family ERP29 C domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S7DY59
Sequence length 368
Comment (tr|A0A0S7DY59|A0A0S7DY59_9EURO) Protein disulfide-isomerase tigA {ECO:0000313|EMBL:GAQ09706.1} KW=Complete proteome; Reference proteome OX=293939 OS=Aspergillus lentulus. GN=ALT_7027 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MARLSFLLVSCLTLLVGIASATSAVIDLLPKNFDDVVLKSGKPALVEFFAPWCGHCKNLA
PVYEELAQAFEFAKDKVTVAKVDADEHRDLGKRFGVQGFPTLKWFDGKSDKPEDYKGGRD
LESLSAFIAEKTGIKPRGAKKEPSKVEMLTESSWKSTIGGDKNVLVAFTAPWCGHCKSLA
PTWETLANDFALEPNVVIAKVDAEAENSKALAKEQGVTGYPTIKFFPKGSTEPIVYNGAR
SEEAFIEFLNANAGTNRAVGGGLNEKAGTVAAFDEFITNYVSSRNVKELVAEVKKAAKGL
QDKYAQYYVKVAEKISQNEEYASKELARLKKILEKGGSAPEKIDDIVSRSNILRKFVGEK
DTDAKDEL
Download sequence
Identical sequences A0A0S7DY59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]