SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7FLB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7FLB1
Domain Number 1 Region: 54-133
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 4.32e-29
Family Surp module (SWAP domain) 0.0000388
Further Details:      
 
Domain Number 2 Region: 167-247
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 5.36e-27
Family Surp module (SWAP domain) 0.0000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S7FLB1
Sequence length 265
Comment (tr|A0A0S7FLB1|A0A0S7FLB1_9TELE) SF3A1 {ECO:0000313|EMBL:JAO16400.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=SF3A1 OC=Poeciliinae; Poeciliopsis.
Sequence
MLKLDCFGLVFLFSISIELNRKINHSVVNCNFFYKVRLCSRVVTFELFNICEFYQQNDGP
AEETPATKPIVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDP
YHAYYRHKVNEFKEGKAQEPSAAVPKVMQQQAMQQSQQLPQKVQSQVIQETVVPKEPPPD
FEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFT
KLVEQYTKILIPPKGLIITYNSSFF
Download sequence
Identical sequences A0A0S7FLB1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]