SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7G3D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7G3D5
Domain Number 1 Region: 47-92
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000131
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 4-51
Classification Level Classification E-value
Superfamily Sema domain 0.0000000196
Family Sema domain 0.016
Further Details:      
 
Domain Number 3 Region: 115-176
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000474
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S7G3D5
Sequence length 216
Comment (tr|A0A0S7G3D5|A0A0S7G3D5_9TELE) SEM7A {ECO:0000313|EMBL:JAO23718.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=SEM7A OC=Poeciliinae; Poeciliopsis.
Sequence
MESHSFVIAEYQPFNHSAHILNLVLNPSTKKLYVNSQTELVQIDVGNCGQYGNNCQDCVL
SRDPYCGWKKKQCTSETSGTLQDVIHGNHSICLEDQASSLPRLAEGTKSHVDNSMKKITV
TSESSYFLRCPVSSHYAQYTWKTPEGSSSCNPKYDECLLLIDSMTSNHQGMYKCESEEMG
YRKVLAKYELTPSSAGRTFCPTVWIFVAAVLRSVWF
Download sequence
Identical sequences A0A0S7G3D5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]