SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7HDS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7HDS3
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily HSP20-like chaperones 9.24e-34
Family Co-chaperone p23-like 0.00000836
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S7HDS3
Sequence length 163
Comment (tr|A0A0S7HDS3|A0A0S7HDS3_9TELE) TEBP {ECO:0000313|EMBL:JAO39240.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=TEBP OC=Poeciliinae; Poeciliopsis.
Sequence
MLPATAKWYDRRDSVFIEFCVADSKDVKVNFDKTKCGFSCVTGTDNVKLENQIDLFEAID
ENESKHNRTDRSVLCYLRKAQPGKAWPRLTKEKAKVSWLSVDFNNWKDWEDDSDEELGNF
DQFSNMMRNMGGEDDLDNLDVDADGADDDDSADSDDEKMPDLE
Download sequence
Identical sequences A0A0S7HDS3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]