SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7JLU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7JLU7
Domain Number 1 Region: 109-212
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-21
Family Integrin domains 0.0036
Further Details:      
 
Domain Number 2 Region: 9-107
Classification Level Classification E-value
Superfamily Integrin domains 0.00000863
Family Integrin domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S7JLU7
Sequence length 229
Comment (tr|A0A0S7JLU7|A0A0S7JLU7_9TELE) ITAX {ECO:0000313|EMBL:JAO66145.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=ITAX OC=Poeciliinae; Poeciliopsis.
Sequence
SNVNEAKAQVNFTLTLDANRKIPNNRAEISKDVRHKSGSLNLNLNRRECTDVDFFIESCP
EDALNPLNNELRFTFDGLPSGSNPRPSLSPQVKTTTFHPIGFEISCGADEVCEDNLKVDF
NFTKSSVVRVGIDELVNVTVSVKNRGENSYNSRITLTYPVGLSYRKVTRLEGRIECNSVD
SEDGVTKGKTVCSIDKPIFRSNSAVSLCCSFTHYLSRRGRLLIPLSFPF
Download sequence
Identical sequences A0A0S7JLU7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]