SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0S7JQF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7JQF1
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.89e-111
Family Capz alpha-1 subunit 0.000000000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S7JQF1
Sequence length 286
Comment (tr|A0A0S7JQF1|A0A0S7JQF1_9TELE) CAZA1 {ECO:0000313|EMBL:JAO66763.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=CAZA1 OC=Poeciliinae; Poeciliopsis.
Sequence
MADFEEPLSDEEKVRIAANFVTHAPPGEFNEVFNDVRLLLNNDNLLREGASQSFAQYNMD
QFTPAKIEGYEEPVLITEHGDLGQGRFLDPRNRLSFRFDHLRKEVSDVQPYDGEGALRSW
RDACDTALSAYVKEHYLTGVCTVYEKTVDGQQTIIACIEGHQFQPKNFWNGRCRSEWKLT
LGQSTAHVVGVLKIQVHYYEDGNVQLVSHKEVENSVPVTSESQTAKEFIDIIRTAENEYQ
TAIIENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNV
Download sequence
Identical sequences A0A0S7JQF1 M3ZZI1
ENSXMAP00000007625 XP_005811282.1.87360 ENSXMAP00000007625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]