SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7KG86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7KG86
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-50
Family Calponin-homology domain, CH-domain 0.000000441
Further Details:      
 
Domain Number 2 Region: 182-243
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.09e-22
Family EB1 dimerisation domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S7KG86
Sequence length 259
Comment (tr|A0A0S7KG86|A0A0S7KG86_9TELE) MARE3 {ECO:0000313|EMBL:JAO76332.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=MARE3 OC=Poeciliinae; Poeciliopsis.
Sequence
MAVNVYSTSMTADNLSRHDMLAWVNDSLQLTYTKIEQLCSGAAYCQFMDMLFPGCILLKK
VKFNAKLEHEYIHNFKVLQAAFKRMNVDKIIPVERLVKGKFQDNFEFLQWFKRFFDANYD
GKEYDPLLMRQGQDGTPPPPNPGPMRTSPTAPKTVPVPQRQINPPAARRNNPVTRNGGDA
ELVELNQQIMDMKLTIDGLEKERDFYFGKLRDIELICQENENDNNPVLGKIIDILYATEE
GFAPPEDEEIDEGRDQQEF
Download sequence
Identical sequences A0A0S7KG86

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]