SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0S7KH46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7KH46
Domain Number 1 Region: 237-435
Classification Level Classification E-value
Superfamily MIR domain 2.96e-62
Family MIR domain 0.0000000681
Further Details:      
 
Domain Number 2 Region: 437-602
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.03e-52
Family IP3 receptor type 1 binding core, domain 2 0.000000459
Further Details:      
 
Domain Number 3 Region: 108-219
Classification Level Classification E-value
Superfamily MIR domain 5.23e-21
Family MIR domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S7KH46
Sequence length 668
Comment (tr|A0A0S7KH46|A0A0S7KH46_9TELE) ITPR2 {ECO:0000313|EMBL:JAO76636.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=ITPR2 OC=Poeciliinae; Poeciliopsis.
Sequence
MSEHRSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPDAGDLANPPKKFRDCLFKV
CPMNRYSAQKQFWKAKQGKQGNNNTQAELFKKLQHAAELEQKQNETENKKLLGDVVKYSS
VIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDPAGNEGSWFYIQPFWKLRSEGDNVVVG
DKVVLMPVNAGQPLHASNIELLDNRGCKEVNALNCNTSWKVTLFMKFSDYKEDILKGGDV
VRLFHAEQEKFLTGDEYRKQQHVFLRTTLRQSATSATSSKALWEIEVVHYDPCRGGAGQW
NSLFRFKHLATGNYLAAEMNPEFKNGTAESQGENETDAGFSKRKHQAAERIAYTLVSVPH
GNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTNIAIDTEEERPVMLKIGT
CSTKEDKEAFAIVSVPLSEVRDLDFANDANQVLESTVKKLKFANITQNERRFVTTLLEDL
IFFVCVVPNNGQDVLSVVTSTPNRERQKLMREQNILFQIFGILTAPFKDNYDGPMLRLEE
LGDQRYSHFKYMFRLCYRILRHSQQDYRKNQEYIATKFPIMQSQMGYEILAEDTITALLH
NNRKLLEKHITAREIETFVSLLRRNREPRFLDYLSDLCASNKTAIPVTQELIIKFMINPV
NADILIQT
Download sequence
Identical sequences A0A0S7KH46

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]