SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7LUW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7LUW4
Domain Number 1 Region: 119-161
Classification Level Classification E-value
Superfamily BEACH domain 1.7e-21
Family BEACH domain 0.00044
Further Details:      
 
Domain Number 2 Region: 2-90
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000111
Family PreBEACH PH-like domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S7LUW4
Sequence length 161
Comment (tr|A0A0S7LUW4|A0A0S7LUW4_9TELE) WDFY4 {ECO:0000313|EMBL:JAO93245.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=WDFY4 OC=Poeciliinae; Poeciliopsis.
Sequence
MLLCEGFTLNSTGDVCCRRHHPSSVKDSFISTVLNKELSSATCRRWLYEDIKEARFMRFL
LEDNTIEIFMKNGHSAFLVFMNKDHVSAYKRLSRVVPALKGRAVADVITNAKKTPVVEKT
ALVKWQKGEMSNFEYLMHLNTIAGRTYNDLMQYPVFPWILA
Download sequence
Identical sequences A0A0S7LUW4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]